carpetmart.comAirbase Lomax Carpet & Tile Mart - Carpet & Tile Mart

carpetmart.com Profile

carpetmart.com is a domain that was created on 1996-06-11,making it 28 years ago. It has several subdomains, such as blog.carpetmart.com shop.carpetmart.com , among others.

Description:Carpet & Tile Mart is a 3rd Generation, Family-Owned and Operated Business, Built Upon a Proud Heritage of Providing Customers a Unique Combination of Unprecedented Value, Massive Selection and...

Keywords:Flooring company, home improvement, flooring sales, floors,...

Discover carpetmart.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

carpetmart.com Information

HomePage size: 296.134 KB
Page Load Time: 0.186664 Seconds
Website IP Address: 172.67.74.194

carpetmart.com Similar Website

Play Mart - Play Mart, Inc.
playmart.pltworkbench.com
- News About Jammer-mart signal jammer blogPROFESSIONAL TECHNOLOGY NEWS AT JAMMER-MART
news.jammer-mart.com
Digital Tile Catalog | Classic Tile Imports
classictileimports.digitaltilecatalog.com
Home - Lomax Elementary School
lxe.lpisd.org
Airbase Services in Linden, NJ - Aircraft Repair & Maintenance
airbase-services-inc.hub.biz
Longmont Carpet, Flooring, & Window Fashions | Carpet Masters of Colorado - Longmont, Co - Carpet Ma
longmont.floorstogo.com
Stone, Porcelain, & Tile | Opustone Stone & Tile Concepts
opustone.flywheelsites.com
Arizona Tile Jobs: Overview | Arizona Tile
jobs.arizonatile.com
J.L. Lomax Elementary School
jllomax.gocats.org
Airbase Lomax Carpet & Tile Mart - Carpet & Tile Mart
shop.carpetmart.com
DURAL Tile Profiles | Flooring Solutions & Tile Installation Systems
us.dural.com
StoneBusiness.com - Online Stone tiles, Laminated Panels, Ceramic tile, Stone Tile & Marble slabs an
1169873.allcraft-kitchens-en-counters.buy.ca.yellowpages.stonebusiness.com

carpetmart.com PopUrls

CarpetMart Flooring Blog - Everything You Need to Know ...
https://blog.carpetmart.com/
Carpet & Tile Mart - CarpetMart
https://shop.carpetmart.com/carpet/
About Us - Carpet & Tile Mart - CarpetMart
https://shop.carpetmart.com/about-us/
Hardwood Flooring - Carpet & Tile Mart
https://shop.carpetmart.com/hardwood/
Lomax Carpet and Tile Mart - Reading, PA
https://shop.carpetmart.com/carpetmart-reading
Employment Opportunities - Carpet & Tile Mart - CarpetMart
https://shop.carpetmart.com/employment
Countertop Info - Carpet Mart
https://shop.carpetmart.com/countertop-info
DuPont Sorona Carpet - Carpet & Tile Mart
https://shop.carpetmart.com/carpet/sorona/
Nubrisa - Carpet & Tile Mart
https://shop.carpetmart.com/carpet/nubrisa/
Airbase Lomax Carpet & Tile Mart - Carpet & Tile Mart
https://shop.carpetmart.com/
Store Locator - Carpet & Tile Mart
https://shop.carpetmart.com/store-locator/
Hours/Locations - Carpet & Tile Mart
https://shop.carpetmart.com/hours-locations/
Area Rugs - Carpet & Tile Mart
https://shop.carpetmart.com/rugs/
How to Buy Carpet - Carpet & Tile Mart
https://shop.carpetmart.com/how-to-buy-carpet/
Getting Replacement Carpet - Carpet Mart - Carpet & Tile Mart
https://shop.carpetmart.com/getting-replacement-carpet/

carpetmart.com DNS

A carpetmart.com. 300 IN A 172.67.74.194
AAAA carpetmart.com. 300 IN AAAA 2606:4700:20::681a:c52
MX carpetmart.com. 300 IN MX 10 d131552a.ess.barracudanetworks.com.
NS carpetmart.com. 86400 IN NS irma.ns.cloudflare.com.
TXT carpetmart.com. 120 IN TXT MS=ms44103183
SOA carpetmart.com. 1800 IN SOA irma.ns.cloudflare.com. dns.cloudflare.com. 2338809643 10000 2400 604800 1800

carpetmart.com Httpheader

Date: Tue, 14 May 2024 23:13:45 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
vary: Accept-Encoding
x-content-type-options: nosniff
x-permitted-cross-domain-policies: none
set-cookie: fornax_anonymousId=df38b451-0776-4b36-ad52-5b3b517dcef7; Expires=Thu, 14 May 2026 23:13:44 GMT; Path=/; Secure; SameSite=None, athena_short_visit_id=cd0d5fd7-155c-487c-8fed-86440a819a58:1715728424; Expires=Tue, 14 May 2024 23:43:44 GMT; Path=/; Secure; HttpOnly; SameSite=None, SF-CSRF-TOKEN=ed5ceec8-42ad-4598-8117-1cd91ef57d00; Path=/; Secure; SameSite=Strict, Shopper-Pref=E6B7EDBF02EC5B0A21E8E4F804C080EA9503503C-1716333225559-x%7B%22cur%22%3A%22USD%22%7D; Expires=Tue, 21 May 2024 23:13:45 GMT; Path=/; HttpOnly, XSRF-TOKEN=28cc22bf51244273f9ced3a7e59d28cc09958da353a3e8582954411a9ef28208; path=/; Secure; SameSite=none, SHOP_SESSION_TOKEN=50608c01-23c8-4a8c-8c30-80354291dbb3; Expires=Tue, 21 May 2024 23:13:45 GMT; Path=/; Secure; HttpOnly; SameSite=None
link: https://static.klaviyo.com/onsite/js/klaviyo.js?company_id=WgXYmT; rel=preload; as=script, https://ecommplugins-trustboxsettings.trustpilot.com/stores/7rjd0xqdp0.js?settings=1668810009747; rel=preload; as=script, https://widget.trustpilot.com/bootstrap/v5/tp.widget.bootstrap.min.js; rel=preload; as=script, https://analytics.getshogun.com/collector.js; rel=preload; as=script, https://cdn11.bigcommerce.com/s-7rjd0xqdp0/stencil/6230aa90-6ab4-013c-e04f-4e33b7865e67/e/d4dcd400-cca5-013c-3180-6e95e52d5a81/css/theme-87e393b0-6ab8-013c-0bc3-2a947387aef8.css; rel=preload; as=style
expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
pragma: no-cache
x-frame-options: deny
x-request-id: 3917ea6f129b0c46cd0b0ba2fbf5c1fe
strict-transport-security: max-age=300
CF-Cache-Status: DYNAMIC
Report-To: "endpoints":["url":"https:\\/\\/a.nel.cloudflare.com\\/report\\/v4?s=Cm9%2FpyMzbnpd9RIoBCtwTakvxMaOqlArAo7%2FuphoMkwHrWGlhq%2FCleR42CDoBHhExE0EjnGHJ8zTAhArQNBYFjJC6C7RQdS3wHeXcY%2BYOiLGgt9KWQPOT3%2BKLAetaVEaT4coXRggOB%2BA%2BdaUXLkIM18%3D"],"group":"cf-nel","max_age":604800
NEL: "success_fraction":0,"report_to":"cf-nel","max_age":604800
BC-Ray: 1
Server: cloudflare
CF-RAY: 883e949a69c50846-IAD
alt-svc: h3=":443"; ma=86400

carpetmart.com Meta Info

content="Flooring company, home improvement, flooring sales, floors, flooring" name="keywords"/
content="bigcommerce.stencil" name="platform"
content="width=device-width, initial-scale=1" name="viewport"/
content="only light" name="color-scheme"/
content="ah8MymFMJmY-81PRQFSTG0rzMYOb0kbYBm_t-KNX0uA" name="google-site-verification"
content="ge_Fo1BYNT0gWpNcpDMeFne10wxnnhv8Fl6PLpBWD4M" name="google-site-verification"
content="WTrG5uL5ve0PIGDV8-Rn6C1MA7D3AMiI-5aPX0X6iuM" name="google-site-verification"

carpetmart.com Html To Plain Text

Airbase Lomax Carpet & Tile Mart - Carpet & Tile Mart × × Customer Login If you are already registered, please log in. Email Address Password Forgot your password? Create your account and enjoy a new shopping experience. Create A New Account × Review your cart Your cart is emptyHOME Savings Financing Flooring 101 Room Visualizer Services Contact Schedule Measurement Hours/Locations Local Ad Commercial Videos Find A Store Get Coupon 0 Need Help? Contact Us Search RUGS All RUGS Shop Rugs By Color Shop By Style What’s New? Best Sellers Custom Rugs Magnolia Home by Joanna Gaines All Magnolia Home by Joanna Gaines Hayes Hunter Janey Lenna Sarah Cora James Linnea Everly Holloway Kennedy Elliston Graham Newton Rowan Annie Elise Lindsay Myra Carlisle Amber Lewis x Loloi Washable Rugs All Washable Rugs Nourison Grand Washables Shop by Brand All Shop by Brand Bashian Rug Central Oriental Stanton Karastan Nourison 50 to Infinity Kathy Ireland Capel Colonial Mills Concord Global Couristan Momeni Palmetto Living Radici Tayse Calvin Klein Kathy Ireland by Nourison Loloi Tommy Bahama Michael Amini Oriental Weavers Rizzy Nourison Dynamic Rugs Kas Kaleen Kaleen Custom Broadloom Dalyn Milliken Trans-Ocean Nubrisa Surya Urban Rug Craftsmen Transitional Rugs Traditional Rugs Stair and Hallway Runners Indoor-Outdoor Rugs Modern Rugs Braided Rugs Shag Rugs Casual Rugs Themed and Fun Rugs Kids Rugs Sports and Team Rugs Rug Clearance Deals Rug Padding CARPET All CARPET Featured In Stock Carpet Mohawk Carpet Designer Pattern Home Office Indoor-Outdoor Multi Tone Nubrisa Saxony-Texture Sorona Sorona Silk Wide Width Padding TILE All TILE Ceramic Mosaics All Mosaics Free Ship Tile Porcelain Wall Tile Ledger Stone LAMINATE All LAMINATE Shaw Laminate Hardwood Patterns VINYL All VINYL Armstrong LVT Vinyl Plank Vinyl Tile Made In The USA Cali Bamboo COREtec Mannington Pergo Extreme Shaw LVT HARDWOOD All HARDWOOD Bamboo Domestic Species Engineered Domestic Species Exotic Species Engineered Exotic Species Cali Bamboo DEALS All DEALS Clearance Area Rugs Clearance Hard Surface COUNTERTOPS Find A Store Get Coupon Fill Form To Get Coupon Savings Financing Flooring 101 Room Visualizer Services Contact Schedule Measurement Hours/Locations Local Ad Commercial Videos Wish Lists Contact us: 888-926-8930 Home home-new Want to receive a $50 flooring coupon? CLICK HERE Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Stanton Rugs Are Here! Standard sizes & Custom sizing available! Shop Now Luxury Vinyl Tile The easiest waterproof flooring solution. Shop Now! Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Carpet & Tile Mart Available. Affordable. At Your Service. Contact An Expert Today Stanton Rugs Shop Now Waterproof Vinyl Shop Now! NATIONAL KARASTAN MONTH IS HERE! | SEE YOUR LOCAL STORE FOR DETAILS FIND A STORE SCHEDULE A MEASURMENT WANT SAVINGS? Start Shopping Now! Shop In-Store Shop Online CARPET Carpet: It’s In Our DNA Installed Wall to Wall or Cash & Carry Out the Door. Carpet: It’s In Our DNA In-Home Measurement Browse Carpet Online See Our Catalog of Always In-Stock Carpet. Additional Selections Available In Store. Browse Carpet Browse Products VINYL Water Worries? We Carry the Larges t Selection Of Waterproof LVP, LVT and Sheet Vinyl. Water Worries? Find A Store Browse Vinyl Get Vinyl Floors Shipped Direct to Your Door or Shop Online and Pick Up In-Store Shop Vinyl Shop Now AREA RUGS We’ve Got You Covered Shop Thousands of Rugs at Each of Our 14 Locations We’ve Got You Covered Find A Store Browse Rugs Thousands of Selections To Choose From. Direct to Your Door Shop Rugs Shop Now TILE Miles Of Tile All the Looks & Styles You Love At a Price You’ll Love Even More. Professional Installation Available! Miles Of Tile Get A Quote Today Browse Tile Get Tile Shipped Direct to Your Door, or Shop Online & Pick Up In-Store Shop Tile Shop Now HARDWOOD Looking to Upgrade? It’s Hard to Beat The Classics. Ask One of Our Specialists About All the Styles and Species We Carry Looking To Upgrade? Find A Store Browse Hardwood Get Hardwood Floors Shipped Direct to Your Door or Shop Online and Pick Up In-Store Shop Hardwood Shop Now LAMINATE Love Laminate? So Do We & Better Yet We Have the Largest Variety of Options for Every Budget. Start by Getting a Quote Today! Love Laminate? Get A Quote Browse Laminate Get Laminate Floors Shipped Direct to Your Door Or Shop Online and Pick Up In-Store Shop Laminate Shop Now Experience The Carpet & Tile Mart Difference Live Customer Service Low Price Guarentee Nationwide Shipping Live Customer Service Low Price Guarantee Nationwide Shipping Get Started We’re Hiring Apply Now Free Carpet Installation Find Your Local StoreCarpet & Tile Mart is a 3rd Generation, Family-Owned and Operated Business, Built Upon a Proud Heritage of Providing Customers a Unique Combination of Unprecedented Value, Massive Selection and Unsurpassed Customer Service. We Carry a Wide Variety of Flooring Options for Your Home, Available to Pick Up in Our Stores, Shipped to You Anywhere in the USA, or Installed as soon as You Need It by our Professional Installers! We Have Thousands of Area Rugs In-Stock, Miles of the Finest Tile and Natural Stone, Durable Luxury Vinyl Tile, Hardwood Flooring made in USA, and of Course the Largest In-Stock Selection of Carpet Around. We Operate 14 Flooring Superstores Serving Delaware, Pennsylvania, Maryland, South Jersey and South Carolina. Now We Are Bringing the Carpet & Tile Mart Value Proposition and Buying Power Within Reach of Flooring Customers from Coast to Coast in the US. LEARN MORE CategoriesRUGSCARPETTILELAMINATEVINYLHARDWOODDEALSCOUNTERTOPS RUGS CARPET TILE LAMINATE VINYL HARDWOOD DEALS COUNTERTOPS Quick Links Contact Us Shipping & Returns FAQ Store Locator About Carpet & Tile Mart Our Story Careers Sub-contractor Application Privacy & Use Terms & Conditions Privacy Statement © 2024 Airbase Carpet & Tile Mart All Rights Reserved. | 1-888-926-8930 | * - tax free in all states except CA, PA, NJ and SC Sign in Login Credentials Email Address * Password * Register Forgot your...

carpetmart.com Whois

Domain Name: CARPETMART.COM Registry Domain ID: 152173_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.networksolutions.com Registrar URL: http://networksolutions.com Updated Date: 2018-03-29T11:13:12Z Creation Date: 1996-06-11T04:00:00Z Registry Expiry Date: 2028-03-29T04:16:11Z Registrar: Network Solutions, LLC Registrar IANA ID: 2 Registrar Abuse Contact Email: domain.operations@web.com Registrar Abuse Contact Phone: +1.8777228662 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: IRMA.NS.CLOUDFLARE.COM Name Server: THEO.NS.CLOUDFLARE.COM DNSSEC: unsigned >>> Last update of whois database: 2024-05-17T13:27:57Z <<<